| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cholecystokinin |
|---|
| Ligand | BDBM2 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_2669 |
|---|
| Citation |  Van Dijk, A; Richards, JG; Trzeciak, A; Gillessen, D; Möhler, H Cholecystokinin receptors: biochemical demonstration and autoradiographical localization in rat brain and pancreas using [3H] cholecystokinin8 as radioligand. J Neurosci4:1021-33 (1984) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Cholecystokinin |
|---|
| Name: | Cholecystokinin |
|---|
| Synonyms: | CCKN_RAT | Cck |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12844.29 |
|---|
| Organism: | RAT |
|---|
| Description: | Cholecystokinin 0 RAT::P01355 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGA
LLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
|
|
|
|---|
| BDBM2 |
|---|
| n/a |
|---|
| Name | BDBM2 |
|---|
| Synonyms: | ({[({[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}(hydroxy)phosphoryl)oxy](hydroxy)phosphoryl}oxy)phosphonic acid | ATP | Brimonidine ATP | CHEMBL14249 |
|---|
| Type | Nucleoside or nucleotide |
|---|
| Emp. Form. | C10H16N5O13P3 |
|---|
| Mol. Mass. | 507.181 |
|---|
| SMILES | Nc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](O)[C@H]1O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
