| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cholecystokinin |
|---|
| Ligand | BDBM81963 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 8.8±n/a nM |
|---|
| Comments | PDSP_2672 |
|---|
| Citation |  Van Dijk, A; Richards, JG; Trzeciak, A; Gillessen, D; Möhler, H Cholecystokinin receptors: biochemical demonstration and autoradiographical localization in rat brain and pancreas using [3H] cholecystokinin8 as radioligand. J Neurosci4:1021-33 (1984) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Cholecystokinin |
|---|
| Name: | Cholecystokinin |
|---|
| Synonyms: | CCKN_RAT | Cck |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12844.29 |
|---|
| Organism: | RAT |
|---|
| Description: | Cholecystokinin 0 RAT::P01355 |
|---|
| Residue: | 115 |
|---|
| Sequence: | MKCGVCLCVVMAVLAAGALAQPVVPVEAVDPMEQRAEEAPRRQLRAVLRPDSEPRARLGA
LLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDFGRRSAEDYEYPS
|
|
|
|---|
| BDBM81963 |
|---|
| n/a |
|---|
| Name | BDBM81963 |
|---|
| Synonyms: | CAS_9011-97-6 | CCK | CCK33 | CHOLECYSTOKININ |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C166H261N51O52S4 |
|---|
| Mol. Mass. | 3931.419 |
|---|
| SMILES | n/a |
|---|
| Structure | 
|
|---|
Search and Browse
