Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR7
LigandBDBM50014406
Substrate/Competitorn/a
Ki 1258.92±n/a nM
CommentsPDSP_154
Citation Tsou APKosaka ABach CZuppan PYee CTom LAlvarez RRamsey SBonhaus DWStefanich E Cloning and expression of a 5-hydroxytryptamine7 receptor positively coupled to adenylyl cyclase. J Neurochem 63:456-64 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
HTR7
Name:HTR7
Synonyms:5-HT7 | 5-HT7L | Serotonin 7 (5-HT7) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:49632.36
Organism:GUINEA PIG
Description:5-HT7 HTR7 GUINEA PIG::P50407
Residue:446
Sequence:
MMGVNSSGRPDLYGHLHSILLPGRGLPDWSPDGGADPGVSTWTPRLLSGVPEVAASPSPS
WDGTWDNVSGCGEQINYGRAEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYL
IVSLALADLSVAVAVIPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISID
RYLGITRPLTYPVRQNGKCMPKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGY
TIYSTAVAFYIPMSVMLFMYYRIYKAARKSAAKHKFPGFPRVQPESIISLNGMVKLQKEV
EECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTACS
CIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEAL
KLAERPERPECVLQNSDYCRKKGHDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014406
n/a
NameBDBM50014406
Synonyms:2-Me 5-HT | 2-Methyl-5-hydroxytryptamine | 2-methyl-5-HT | 2-methylserotonin | 3-(2-aminoethyl)-2-methyl-1H-indol-5-ol | 5-HT,2-Me | CHEMBL266591
TypeSmall organic molecule
Emp. Form.C11H14N2O
Mol. Mass.190.2417
SMILESCc1[nH]c2ccc(O)cc2c1CCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: