Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT3A Serotonin Receptor
LigandBDBM22869
Substrate/Competitorn/a
Ki 90±n/a nM
CommentsPDSP_552
Citation Leysen JEJanssen PMMegens AASchotte A Risperidone: a novel antipsychotic with balanced serotonin-dopamine antagonism, receptor occupancy profile, and pharmacologic activity. J Clin Psychiatry 0:5-12 (1994) [PubMed]
More Info.:Get all data from this article
 
5-HT3A Serotonin Receptor
Name:5-HT3A Serotonin Receptor
Synonyms:5-HT-3 | 5-HT3-A | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 | 5-hydroxytryptamine receptor 3A | 5ht3 | Htr3 | Htr3a | Serotonin 3 receptor (5HT3) | Serotonin 3a (5-HT3a) receptor | Serotonin receptor 3A | Serotonin-gated ion channel receptor
Type:n/a
Mol. Mass.:56056.00
Organism:Mus musculus (house mouse)
Description:5HT3A
Residue:487
Sequence:
MRLCIPQVLLALFLSMLTAPGEGSRRRATQEDTTQPALLRLSDHLLANYKKGVRPVRDWR
KPTTVSIDVIMYAILNVDEKNQVLTTYIWYRQYWTDEFLQWTPEDFDNVTKLSIPTDSIW
VPDILINEFVDVGKSPNIPYVYVHHRGEVQNYKPLQLVTACSLDIYNFPFDVQNCSLTFT
SWLHTIQDINITLWRSPEEVRSDKSIFINQGEWELLEVFPQFKEFSIDISNSYAEMKFYV
IIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDSGERVSFKITLLLGYSVFLIIVSDTLP
ATIGTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQRPVPDWLRHLVLDRIAWILCL
GEQPMAHRPPATFQANKTDDCSGSDLLPAMGNHCSHVGGPQDLEKTPRGRGSPLPPPREA
SLAVRGLLQELSSIRHFLEKRDEMREVARDWLRVGYVLDRLLFRIYLLAVLAYSITLVTL
WSIWHYS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22869
n/a
NameBDBM22869
Synonyms:6-chloro-10-(4-methylpiperazin-1-yl)-2,9-diazatricyclo[9.4.0.0^{3,8}]pentadeca-1,3(8),4,6,10,12,14-heptaene | CLOZARIL | Clozapine | Leponex
TypeSmall organic molecule
Emp. Form.C18H19ClN4
Mol. Mass.326.823
SMILESCN1CCN(CC1)C1=c2ccccc2=Nc2ccc(Cl)cc2N1 |c:8,15|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: