Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin receptor 2a and 2b (5HT2A and 5HT2B)
LigandBDBM10755
Substrate/Competitorn/a
Ki 10±n/a nM
CommentsPDSP_150
Citation Bonhaus DWBach CDeSouza ASalazar FHMatsuoka BDZuppan PChan HWEglen RM The pharmacology and distribution of human 5-hydroxytryptamine2B (5-HT2B) receptor gene products: comparison with 5-HT2A and 5-HT2C receptors. Br J Pharmacol 115:622-8 (1995) [PubMed]  Article
More Info.:Get all data from this article
 
Serotonin receptor 2a and 2b (5HT2A and 5HT2B)
Name:Serotonin receptor 2a and 2b (5HT2A and 5HT2B)
Synonyms:5-HT2B | 5-hydroxytryptamine receptor 2B | HTR2B | Serotonin 2b (5-HT2b) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:53668.47
Organism:RAT
Description:5-HT2B HTR2B RAT::P30994
Residue:479
Sequence:
MASSYKMSEQSTISEHILQKTCDHLILTDRSGLKAESAAEEMKQTAENQGNTVHWAALLI
FAVIIPTIGGNILVILAVSLEKRLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEATW
PLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQANQCNSRTTAFVKITVVWL
ISIGIAIPVPIKGIEADVVNAHNITCELTKDRFGSFMLFGSLAAFFAPLTIMIVTYFLTI
HALRKKAYLVRNRPPQRLTRWTVSTVLQREDSSFSSPEKMVMLDGSHKDKILPNSTDETL
MRRMSSAGKKPAQTISNEQRASKVLGIVFLFFLLMWCPFFITNVTLALCDSCNQTTLKTL
LQIFVWVGYVSSGVNPLIYTLFNKTFREAFGRYITCNYQATKSVKVLRKCSSTLYFGNSM
VENSKFFTKHGIRNGINPAMYQSPVRLRSSTIQSSSIILLNTFLTENDGDKVEDQVSYI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
n/a
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: