Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 2
LigandBDBM82280
Substrate/Competitorn/a
Ki 0.67±n/a nM
CommentsPDSP_1564
Citation Gerald CWalker MWVaysse PJHe CBranchek TAWeinshank RL Expression cloning and pharmacological characterization of a human hippocampal neuropeptide Y/peptide YY Y2 receptor subtype. J Biol Chem 270:26758-61 (1995) [PubMed]
More Info.:Get all data from this article
 
Neuropeptide Y receptor type 2
Name:Neuropeptide Y receptor type 2
Synonyms:NPY-Y2 | NPY-Y2 receptor | NPY2-R | NPY2R | Neuropeptide Y receptor type 2 | Y2 receptor | neuropeptide Y receptor Y2
Type:Enzyme Catalytic Domain
Mol. Mass.:42734.65
Organism:Homo sapiens (Human)
Description:NPY-Y2 NPY2R HUMAN::P49146
Residue:381
Sequence:
MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82280
n/a
NameBDBM82280
Synonyms:PYY3-36, human
TypeSmall organic molecule
Emp. Form.C180H278N52O55
Mol. Mass.4050.4487
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: