Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR7
LigandBDBM22872
Substrate/Competitorn/a
Ki 32.35±n/a nM
CommentsPDSP_1402
Citation To ZPBonhaus DWEglen RMJakeman LB Characterization and distribution of putative 5-ht7 receptors in guinea-pig brain. Br J Pharmacol 115:107-16 (1995) [PubMed]  Article
More Info.:Get all data from this article
 
HTR7
Name:HTR7
Synonyms:5-HT7 | 5-HT7L | Serotonin 7 (5-HT7) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:49632.36
Organism:GUINEA PIG
Description:5-HT7 HTR7 GUINEA PIG::P50407
Residue:446
Sequence:
MMGVNSSGRPDLYGHLHSILLPGRGLPDWSPDGGADPGVSTWTPRLLSGVPEVAASPSPS
WDGTWDNVSGCGEQINYGRAEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYL
IVSLALADLSVAVAVIPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISID
RYLGITRPLTYPVRQNGKCMPKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGY
TIYSTAVAFYIPMSVMLFMYYRIYKAARKSAAKHKFPGFPRVQPESIISLNGMVKLQKEV
EECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTACS
CIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEAL
KLAERPERPECVLQNSDYCRKKGHDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22872
n/a
NameBDBM22872
Synonyms:1-(3-chloro-5,6-dihydrobenzo[b][1]benzothiepin-5-yl)-4-methyl-piperazine;maleate | 1-(8-chloro-10,11-dihydrodibenzo[b,f]thiepin-10-yl)-4-methylpiperazine | 1-{6-chloro-2-thiatricyclo[9.4.0.0^{3,8}]pentadeca-1(15),3(8),4,6,11,13-hexaen-9-yl}-4-methylpiperazine | CHEMBL64249 | CLOROTEPINE (+) | CLOROTEPINE(-) | Clothepin | OCTOCLOTHEPIN,(+) | OCTOCLOTHEPIN,(-) | Octoclothepin | Octoclothepine
TypeSmall organic molecule
Emp. Form.C19H21ClN2S
Mol. Mass.344.901
SMILESCN1CCN(CC1)C1Cc2ccccc2Sc2ccc(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: