Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR6
LigandBDBM50280053
Substrate/Competitorn/a
Ki 161±n/a nM
CommentsPDSP_667
Citation Monsma FJShen YWard RPHamblin MWSibley DR Cloning and expression of a novel serotonin receptor with high affinity for tricyclic psychotropic drugs. Mol Pharmacol 43:320-7 (1993) [PubMed]
More Info.:Get all data from this article
 
HTR6
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-6 | 5-HT6 | 5-hydroxytryptamine receptor 6 | ST-B17 | Serotonin 6 (5-HT6) receptor | Serotonin receptor 6
Type:Enzyme Catalytic Domain
Mol. Mass.:46945.51
Organism:RAT
Description:5-HT6 HTR6 RAT::P31388
Residue:436
Sequence:
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIVLICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTPAPGQC
RLLASLPFVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTAGQALETLQVP
RTPRPGMESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIAQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCVHCPPEHRPALPPPPCGPLTAVP
DQASACSRCCLCLCRQTQIQTPLQGAPRACSSQPSFCCLERPPGTPRHPPGPPLWSTSLS
QTLWSLRYGRIHSVPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50280053
n/a
NameBDBM50280053
Synonyms:7-Methyl-4,6,6a,7,8,9,10,10a-octahydro-indolo[4,3-fg]quinoline-9-carboxylic acid ((2R,5S,10bS)-10b-hydroxy-5-isobutyl-2-isopropyl-3,6-dioxo-octahydro-oxazolo[3,2-a]pyrrolo[2,1-c]pyrazin-2-yl)-amide | CHEMBL18329 | DHC | DIHYDROERGOCRYPTINE
TypeSmall organic molecule
Emp. Form.C32H43N5O5
Mol. Mass.577.7143
SMILESCC(C)C[C@@H]1N2C(=O)[C@](NC(=O)C3CC4C(Cc5c[nH]c6cccc4c56)N(C)C3)(O[C@@]2(O)C2CCCN2C1=O)C(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: