Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylcholinesterase (AChE)
LigandBDBM50060582
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
pH4±0
Temperature298.15±0 K
IC50 1063±42 nM
Citation Bunyapaiboonsri TRamström OLohmann SLehn JMPeng LGoeldner M Dynamic deconvolution of a pre-equilibrated dynamic combinatorial library of acetylcholinesterase inhibitors. Chembiochem 2:438-44 (2001) [PubMed]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Acetylcholinesterase (AChE)
Name:Acetylcholinesterase (AChE)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:66739.82
Organism:Torpedo marmorata (Marbled electric ray)
Description:P07692
Residue:590
Sequence:
MREMNLLVTSSLGVLLHLVVLCQADDDSELLVNTKSGKVMRTRIPVLSSHISAFLGIPFA
EPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFPGSEMWNPNREMSEDCLY
LNIWVPSPRPKSATVMLWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFL
ALHGSQEAPGNMGLLDQRMALQWVHDNIQFFGGDPKTVTLFGESAGRASVGMHILSPGSR
DLFRRAILQSGSPNCPWASVSVAEGRRRAVELRRNLNCNLNSDEDLIQCLREKKPQELID
VEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNAGNFKKTQILLGVNKDEGSFFLLYGA
PGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVG
DHNVICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKEL
NYTAEEEALSRRIMHYWATFAKTGNPNEPHSQESKWPLFTTKEQKFIDLNTEPIKVHQRL
RVQMCVFWNQFLPKLLNATACDGELSSSGTSSSKGIIFYVLFSILYLIFY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50060582
n/a
NameBDBM50060582
Synonyms:1,10-Bis(trimethyl ammonium)decane dibromide | 1,10-bis-(trimethyl ammonium) decane dibromide | CHEMBL1134 | DECAMETHONIUM | DECAMETHONIUM BROMIDE | Decamethonium Iodide | N,N,N'',N''-Tetramethyl-decane-1,10-diammonium; dibromide | N,N,N,N'',N'',N''-Hexamethyldecane-1,10-diammoniumdibromide | Syncurine | decane-1,10-bis(trimethylammonium bromide)
TypeSmall organic molecule
Emp. Form.C16H38N2
Mol. Mass.258.4852
SMILESC[N+](C)(C)CCCCCCCCCC[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: