| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 5A |
|---|
| Ligand | BDBM9019 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_1189 |
|---|
| Citation |  Erlander, MG; Lovenberg, TW; Baron, BM; de Lecea, L; Danielson, PE; Racke, M; Slone, AL; Siegel, BW; Foye, PE; Cannon, K Two members of a distinct subfamily of 5-hydroxytryptamine receptors differentially expressed in rat brain. Proc Natl Acad Sci U S A90:3452-6 (1993) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| 5-hydroxytryptamine receptor 5A |
|---|
| Name: | 5-hydroxytryptamine receptor 5A |
|---|
| Synonyms: | 5-HT-5A | 5-HT5a | 5-hydroxytryptamine receptor 5A | 5HT5A_RAT | 5ht5a | Htr5a | REC17 | Serotonin (5-HT) receptor | Serotonin receptor 5A |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 40684.21 |
|---|
| Organism: | RAT |
|---|
| Description: | 5-HT5a HTR5A RAT::P35364 |
|---|
| Residue: | 357 |
|---|
| Sequence: | MDLPINLTSFSLSTPSTLEPNRSLDTEALRTSQSFLSAFRVLVLTLLGFLAAATFTWNLL
VLATILRVRTFHRVPHNLVASMAISDVLVAVLVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHLEYTLRARKRVSNVMILLTWALSAVISLAPLLFG
WGETYSELSEECQVSREPSYTVFSTVGAFYLPLCVVLFVYWKIYKAAKFRMGSRKTNSVS
PIPEAVEVKDASQHPQMVFTVRHATVTFQTEGDTWREQKEQRAALMVGILIGVFVLCWFP
FFVTELISPLCSWDIPALWKSIFLWLGYSNSFFNPLIYTAFNRSYSSAFKVFFSKQQ
|
|
|
|---|
| BDBM9019 |
|---|
| n/a |
|---|
| Name | BDBM9019 |
|---|
| Synonyms: | CHEMBL45 | Melatonin | N-[2-(5-methoxy-1H-indol-3-yl)ethyl]acetamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H16N2O2 |
|---|
| Mol. Mass. | 232.2783 |
|---|
| SMILES | COc1ccc2[nH]cc(CCNC(C)=O)c2c1 |
|---|
| Structure | 
|
|---|
Search and Browse
