Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT5B
LigandBDBM21393
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_205
Citation Erlander MGLovenberg TWBaron BMde Lecea LDanielson PERacke MSlone ALSiegel BWFoye PECannon K Two members of a distinct subfamily of 5-hydroxytryptamine receptors differentially expressed in rat brain. Proc Natl Acad Sci U S A 90:3452-6 (1993) [PubMed]
More Info.:Get all data from this article
 
5-HT5B
Name:Serotonin (5-HT) receptor
Synonyms:5-hydroxytryptamine receptor 5B | Serotonin 5b (5-HT5b) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41141.95
Organism:RAT
Description:5-HT5B 0 RAT::P35365
Residue:370
Sequence:
MEVSNLSGATPGIAFPPGPESCSDSPSSGRSMGSTPGGLILSGREPPFSAFTVLVVTLLV
LLIAATFLWNLLVLVTILRVRAFHRVPHNLVASTAVSDVLVAALVMPLSLVSELSAGRRW
QLGRSLCHVWISFDVLCCTASIWNVAAIALDRYWTITRHLQYTLRTRRRASALMIAITWA
LSALIALAPLLFGWGEAYDARLQRCQVSQEPSYAVFSTCGAFYVPLAVVLFVYWKIYKAA
KFRFGRRRRAVVPLPATTQAKEAPQESETVFTARCRATVAFQTSGDSWREQKEKRAAMMV
GILIGVFVLCWIPFFLTELVSPLCACSLPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNN
AFKSLFTKQR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21393
n/a
NameBDBM21393
Synonyms:7-(dipropylamino)-5,6,7,8-tetrahydronaphthalen-1-ol | 8-Hydroxy-2-(di-n-propylamino)tetralin | 8-OH-DPAT | 8-OH-DPAT,(+) | 8-OH-DPAT,(-) | 8-hydroxy-N,N-dipropylaminotetralin | CHEMBL1788118 | CHEMBL505765 | CHEMBL56 | DPAT | [3H]-8-OH-DPAT | cid_1220
Typeradiolabeled ligand
Emp. Form.C16H25NO
Mol. Mass.247.3758
SMILESCCCN(CCC)C1CCc2cccc(O)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: