Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-HT5B
LigandBDBM50024204
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_1206
Citation Erlander MGLovenberg TWBaron BMde Lecea LDanielson PERacke MSlone ALSiegel BWFoye PECannon K Two members of a distinct subfamily of 5-hydroxytryptamine receptors differentially expressed in rat brain. Proc Natl Acad Sci U S A 90:3452-6 (1993) [PubMed]
More Info.:Get all data from this article
 
5-HT5B
Name:Serotonin (5-HT) receptor
Synonyms:5-hydroxytryptamine receptor 5B | Serotonin 5b (5-HT5b) receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41141.95
Organism:RAT
Description:5-HT5B 0 RAT::P35365
Residue:370
Sequence:
MEVSNLSGATPGIAFPPGPESCSDSPSSGRSMGSTPGGLILSGREPPFSAFTVLVVTLLV
LLIAATFLWNLLVLVTILRVRAFHRVPHNLVASTAVSDVLVAALVMPLSLVSELSAGRRW
QLGRSLCHVWISFDVLCCTASIWNVAAIALDRYWTITRHLQYTLRTRRRASALMIAITWA
LSALIALAPLLFGWGEAYDARLQRCQVSQEPSYAVFSTCGAFYVPLAVVLFVYWKIYKAA
KFRFGRRRRAVVPLPATTQAKEAPQESETVFTARCRATVAFQTSGDSWREQKEKRAAMMV
GILIGVFVLCWIPFFLTELVSPLCACSLPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNN
AFKSLFTKQR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50024204
n/a
NameBDBM50024204
Synonyms:1H-imidazo[4,5-c]pyridine derivative | 2N-[4,7-dimethyl-(6aR,9S,10aR)-4,6,6a,7,8,9,10,10a-octahydroindolo[4,3-fg]quinolin-9-yl]-2-dimethylaminosulfonamide | 4,7-dimethyl-(6aR,9S,10aR)-4,6,6a,7,8,9,10,10a-octahydroindolo[4,3-fg]quinolin-9-amino-N,N-dimethyl sulfonamide | 4,7-dimethyl-4,6,6a,7,8,9,10,10a-octahydroindolo[4,3-fg]quinolin-9-amine-sulfonamide | 9-N,N-dimethylsulfamide-4,7-dimethyl-4,6,6a,7,8,9,10,10a-octahydro-indolo[4,3-fg]quinoline | CHEMBL12314 | ChEMBL_10959 | MESULERGINE | N'-4,7-Dimethyl-4,6,6a,7,8,9,10,10a-octahydro-indolo[4,3-fg]quinolin-9-yl)-N'-,N'-dimethyl-sulphonediamine
TypeSmall organic molecule
Emp. Form.C18H26N4O2S
Mol. Mass.362.49
SMILESCN(C)S(=O)(=O)N[C@H]1C[C@H]2[C@@H](Cc3cn(C)c4cccc2c34)N(C)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: