| Reaction Details |
|---|
 | Report a problem with these data |
| Target | VIP peptides |
|---|
| Ligand | BDBM50250019 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 0.9±n/a nM |
|---|
| Comments | PDSP_2396 |
|---|
| Citation |  Gourlet, P; Woussen-Colle, MC; Robberecht, P; de Neef, P; Cauvin, A; Vandermeers-Piret, MC; Vandermeers, A; Christophe, J Structural requirements for the binding of the pituitary adenylate-cyclase-activating peptide to receptors and adenylate-cyclase activation in pancreatic and neuronal membranes. Eur J Biochem195:535-41 (1991) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| VIP peptides |
|---|
| Name: | VIP peptides |
|---|
| Synonyms: | VIP peptides | VIP_RAT | Vip |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 19078.15 |
|---|
| Organism: | RAT |
|---|
| Description: | VIP 0 RAT::P01283 |
|---|
| Residue: | 170 |
|---|
| Sequence: | MESRSKPQFLAILTLFSVLFSQSLAWPLYGPPSSVRLDDRLQFEGAGDPDQVSLKADSDI
LQNALAENDTPYYDVSRNARHADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPV
PVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGDSPDFLEELEK
|
|
|
|---|
| BDBM50250019 |
|---|
| n/a |
|---|
| Name | BDBM50250019 |
|---|
| Synonyms: | CHEMBL524658 | PACAP | PACAP(1-38) | PACAP-38 | PACAP38 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C203H331N63O53S |
|---|
| Mol. Mass. | 4534.256 |
|---|
| SMILES | n/a |
|---|
| Structure | 
|
|---|
Search and Browse
