Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM82381
Substrate/Competitorn/a
Ki 5.48±n/a nM
CommentsPDSP_1054
Citation Hwang SBLam MHAlberts AWBugianesi RLChabala JCPonpipom MM Biochemical and pharmacological characterization of L-659,989: an extremely potent, selective and competitive receptor antagonist of platelet-activating factor. J Pharmacol Exp Ther 246:534-41 (1988) [PubMed]
More Info.:Get all data from this article
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF Platelet activating factor | PAF-R | Platelet-activating factor receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:39219.60
Organism:Homo sapiens (Human)
Description:PAF Platelet activating factor PTAFR HUMAN::P25105
Residue:342
Sequence:
MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT
MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT
RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG
SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82381
n/a
NameBDBM82381
Synonyms:L-659,989, (-)
Typen/a
Emp. Form.C24H32O8S
Mol. Mass.480.571
SMILESCCCOc1c(OC)cc(cc1S(C)(=O)=O)[C@H]1CC[C@@H](O1)c1cc(OC)c(OC)c(OC)c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: