Reaction Details |
| Report a problem with these data |
Target | GABA(A) receptor-associated protein |
---|
Ligand | BDBM50060321 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_20 |
---|
Citation | Evans, BE; Bock, MG; Rittle, KE; DiPardo, RM; Whitter, WL; Veber, DF; Anderson, PS; Freidinger, RM Design of potent, orally effective, nonpeptidal antagonists of the peptide hormone cholecystokinin. Proc Natl Acad Sci U S A83:4918-22 (1986) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
GABA(A) receptor-associated protein |
---|
Name: | GABA(A) receptor-associated protein |
Synonyms: | GABA A Benzodiazepine | GABA-A receptor subunit alpha 1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 13921.89 |
Organism: | GUINEA PIG |
Description: | D7RA28 |
Residue: | 117 |
Sequence: | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
|
|
|
BDBM50060321 |
---|
n/a |
---|
Name | BDBM50060321 |
Synonyms: | 1H-Indole-2-carboxylic acid ((R)-1-methyl-2-oxo-5-phenyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-3-yl)-amide | 1H-Indole-2-carboxylic acid (1-methyl-2-oxo-5-phenyl-2,3-dihydro-1H-benzo[e][1,4]diazepin-3-yl)-amide | CCK antagonist synthetic 19 | CHEMBL419764 |
Type | Small organic molecule |
Emp. Form. | C25H20N4O2 |
Mol. Mass. | 408.4519 |
SMILES | CN1c2ccccc2C(=N[C@@H](NC(=O)c2cc3ccccc3[nH]2)C1=O)c1ccccc1 |c:9| |
Structure |
|