Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuropeptide Y receptor type 2
LigandBDBM50015490
Substrate/Competitorn/a
Ki 0.54±n/a nM
CommentsPDSP_1377
Citation Gerald CAdham NKao HTOlsen MALaz TMSchechter LEBard JAVaysse PJHartig PRBranchek TA The 5-HT4 receptor: molecular cloning and pharmacological characterization of two splice variants. EMBO J 14:2806-15 (1995) [PubMed]
More Info.:Get all data from this article
 
Neuropeptide Y receptor type 2
Name:Neuropeptide Y receptor type 2
Synonyms:NPY-Y2 | NPY-Y2 receptor | NPY2-R | NPY2R | Neuropeptide Y receptor type 2 | Y2 receptor | neuropeptide Y receptor Y2
Type:Enzyme Catalytic Domain
Mol. Mass.:42734.65
Organism:Homo sapiens (Human)
Description:NPY-Y2 NPY2R HUMAN::P49146
Residue:381
Sequence:
MGPIGAEADENQTVEEMKVEQYGPQTTPRGELVPDPEPELIDSTKLIEVQVVLILAYCSI
ILLGVIGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMGP
VLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALLA
SPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSYT
RIWSKLKNHVSPGAANDHYHQRRQKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSQVLDL
KEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSVTFKAK
KNLEVRKNSGPNDSFTEATNV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015490
n/a
NameBDBM50015490
Synonyms:CHEMBL438945 | H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 | NPY | NPY, human | NPY, human, rat | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro- Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His- Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (NPY) | human Neuropeptide Y
TypeSmall organic molecule
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: