Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT2
LigandBDBM82431
Substrate/Competitorn/a
Ki 0.06±n/a nM
CommentsPDSP_1029
Citation Beauchamp HTChang RSSiegl PKGibson RE In vivo receptor occupancy of the angiotensin II receptor by nonpeptide antagonists: relationship to in vitro affinities and in vivo pharmacologic potency. J Pharmacol Exp Ther 272:612-8 (1995) [PubMed]
More Info.:Get all data from this article
 
Angiotensin II AT2
Name:Angiotensin II receptor
Synonyms:AT2 | Angiotensin II receptor | Angiotensin II type 2 (AT-2) receptor | Type-2 angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:41346.62
Organism:RAT
Description:Angiotensin II AT2 0 0::P35351
Residue:363
Sequence:
MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFA
VNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDT
FVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82431
n/a
NameBDBM82431
Synonyms:L-162,193 | L-162193 | N-[[4-[[[6-[4-(Cyclopropylcarbonyl)-1-piperazinyl]-2-butyl-3,4-dihydro-4-oxoquinazolin]-3-yl]methyl]biphenyl-2'-yl]sulfonyl]carbamic acid butyl ester
TypeSmall organic molecule
Emp. Form.C38H45N5O6S
Mol. Mass.699.859
SMILES[#6]-[#6]-[#6]-[#6]-[#8]-[#6](=O)-[#7][S;v6](=O)(=O)c1ccccc1-c1ccc(-[#6]-n2c(-[#6]-[#6]-[#6]-[#6])nc3ccc(cc3c2=O)-[#7]-2-[#6]-[#6]-[#7](-[#6]-[#6]-2)-[#6](=O)-[#6]-2-[#6]-[#6]-2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: