Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1A adrenergic receptor
LigandBDBM50079527
Substrate/Competitorn/a
Ki 23.5±n/a nM
CommentsPDSP_735
Citation Cusack BNelson ARichelson E Binding of antidepressants to human brain receptors: focus on newer generation compounds. Psychopharmacology (Berl) 114:559-65 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
Alpha-1A adrenergic receptor
Name:Alpha-1A adrenergic receptor
Synonyms:ADRA1A | ADRA1C | Adrenergic alpha1A | Alpha 1A-adrenoceptor | Alpha 1A-adrenoreceptor | Alpha adrenergic receptor 1a | Alpha-1C adrenergic receptor | Alpha-adrenergic receptor 1c | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha1 | adrenergic Alpha1C
Type:Cell-surface receptors
Mol. Mass.:51511.67
Organism:Homo sapiens (Human)
Description:P35348
Residue:466
Sequence:
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50079527
n/a
NameBDBM50079527
Synonyms:(3E)-3-dibenzo[b,e]oxepin-11(6H)-ylidene-N,N-dimethylpropan-1-amine(3Z)-3-dibenzo[b,e]oxepin-11(6H)-ylidene-N,N-dimethylpropan-1-amine | CHEMBL101740 | DOXEPIN | cis-doxepin
TypeSmall organic molecule
Emp. Form.C19H21NO
Mol. Mass.279.3761
SMILESCN(C)CC\C=C1\c2ccccc2COc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: