Reaction Details |
| Report a problem with these data |
Target | Pituitary adenylate cyclase-activating polypeptide |
---|
Ligand | BDBM50250019 |
---|
Substrate/Competitor | n/a |
---|
Ki | 0.3±n/a nM |
---|
Comments | PDSP_2377 |
---|
Citation | Hou, X; Vandermeers, A; Gourlet, P; Vandermeers-Piret, MC; Robberecht, P Structural requirements for the occupancy of rat brain PACAP receptors and adenylate cyclase activation. Neuropharmacology33:1189-95 (1994) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Pituitary adenylate cyclase-activating polypeptide |
---|
Name: | Pituitary adenylate cyclase-activating polypeptide |
Synonyms: | Adcyap1 | PACAP | PACAP-27 | PACAP-38 | PACA_RAT | Pituitary adenylate cyclase-activating polypeptide |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 19565.66 |
Organism: | RAT |
Description: | PACAP 0 RAT::P13589 |
Residue: | 175 |
Sequence: | MTMCSGARLALLVYGIIMHNSVSCSPAAGLSFPGIRPEEEAYDQDGNPLQDFYDWDPPGA
GSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYLQSMVARGMGENLAAAA
VDDRAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
|
|
|
BDBM50250019 |
---|
n/a |
---|
Name | BDBM50250019 |
Synonyms: | CHEMBL524658 | PACAP | PACAP(1-38) | PACAP-38 | PACAP38 |
Type | Small organic molecule |
Emp. Form. | C203H331N63O53S |
Mol. Mass. | 4534.256 |
SMILES | n/a |
Structure |
|