| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Pituitary adenylate cyclase-activating polypeptide |
|---|
| Ligand | BDBM81524 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 2±n/a nM |
|---|
| Comments | PDSP_2358 |
|---|
| Citation |  Hou, X; Vandermeers, A; Gourlet, P; Vandermeers-Piret, MC; Robberecht, P Structural requirements for the occupancy of rat brain PACAP receptors and adenylate cyclase activation. Neuropharmacology33:1189-95 (1994) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Pituitary adenylate cyclase-activating polypeptide |
|---|
| Name: | Pituitary adenylate cyclase-activating polypeptide |
|---|
| Synonyms: | Adcyap1 | PACAP | PACAP-27 | PACAP-38 | PACA_RAT | Pituitary adenylate cyclase-activating polypeptide |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 19565.66 |
|---|
| Organism: | RAT |
|---|
| Description: | PACAP 0 RAT::P13589 |
|---|
| Residue: | 175 |
|---|
| Sequence: | MTMCSGARLALLVYGIIMHNSVSCSPAAGLSFPGIRPEEEAYDQDGNPLQDFYDWDPPGA
GSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYLQSMVARGMGENLAAAA
VDDRAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
|
|
|
|---|
| BDBM81524 |
|---|
| n/a |
|---|
| Name | BDBM81524 |
|---|
| Synonyms: | [Phe2]PACAP(1-38) |
|---|
| Type | Small molecule |
|---|
| Emp. Form. | C209H335N63O52S |
|---|
| Mol. Mass. | 4594.352 |
|---|
| SMILES | n/a |
|---|
| Structure | 
|
|---|
Search and Browse
