Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR3
LigandBDBM82256
Substrate/Competitorn/a
Ki 0.01±n/a nM
CommentsPDSP_385
Citation Hoyer DLübbert HBruns C Molecular pharmacology of somatostatin receptors. Naunyn Schmiedebergs Arch Pharmacol 350:441-53 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
SSTR3
Name:SSTR3
Synonyms:SOMATOSTATIN SST3 | SS3R | SSR-28 | Somatostatin receptor | Somatostatin receptor 3 | Somatostatin receptor type 3
Type:Enzyme Catalytic Domain
Mol. Mass.:47225.49
Organism:MOUSE
Description:SOMATOSTATIN SST3 SSTR3 MOUSE::P30935
Residue:428
Sequence:
MATVTYPSSEPTTLDPGNASSTWPLDTTLGNTSAGASLTGLAVSGILISLVYLVVCVVGL
LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV
MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVV
VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR
VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF
FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRIRSQEPGSGPPEKTEEE
EDEEEEERREEEERRMQRGQEMNGRLSQIAQAGTSGQQPRPCTGTAKEQQLLPQEATAGD
KASTLSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82256
n/a
NameBDBM82256
Synonyms:BIM 23056 | CAS_150155-61-6 | D-Phe-Phe-Tyr-D-Trp-Lys-Val-Phe-D-Nal-NH2 | DC-25-20
TypeSmall organic molecule
Emp. Form.C71H81N11O9
Mol. Mass.1232.4711
SMILESCC(C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](N)Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](Cc1ccc2ccccc2c1)C(N)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: