Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSSTR4
LigandBDBM82465
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_374
Citation Hoyer DLübbert HBruns C Molecular pharmacology of somatostatin receptors. Naunyn Schmiedebergs Arch Pharmacol 350:441-53 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
SSTR4
Name:Somatostatin receptor
Synonyms:Somatostatin receptor 4
Type:PROTEIN
Mol. Mass.:41937.48
Organism:Mus musculus
Description:ChEMBL_833920
Residue:385
Sequence:
MNAPATLPPGVEDTTWTPGINASWAPDEEEEDAMGSDGTGTAGMVTIQCIYALVCLVGLV
GNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFARSAAALRHWPFGAVLCRAVL
SVDGLNMFTSVFCLTVLSVDRYVAVVHPLATATYRRPSVAKLINLGVWLASLLVTLPIAV
FADTRPARGGEAVACNLHWPHPAWSAVFVIYTFLLGFLPPVLAIGLCYLLIVGKMRAVAL
AGGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYAN
SCANPILYGFLSDNFRRSFQRVLCLRCCLLETTGGAEEEPLDYYATALKSRGGAGCICPP
LPCQQEPVQAEPGCKQVPFTKTTTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82465
n/a
NameBDBM82465
Synonyms:BIM 23023 | BIM-23023 | D-Phe-L-Cys(1)-L-Tyr-D-Trp-L-Lys-L-Abu-L-Cys(1)-L-Thr-NH2
TypeSmall organic molecule
Emp. Form.C49H65N11O10S2
Mol. Mass.1032.238
SMILESCC[C@@H]1NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](Cc2ccc(O)cc2)NC(=O)[C@H](CSSC[C@H](NC1=O)C(=O)N[C@@H]([C@@H](C)O)C(N)=O)NC(=O)[C@H](N)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: