Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM50030614
Substrate/Competitorn/a
Ki 54.5±n/a nM
CommentsPDSP_1717
Citation Bockman CSJeffries WBAbel PW Binding and functional characterization of alpha-2 adrenergic receptor subtypes on pig vascular endothelium. J Pharmacol Exp Ther 267:1126-33 (1993) [PubMed]  Article
More Info.:Get all data from this article
 
adrenergic Alpha2
Name:adrenergic Alpha2
Synonyms:Alpha-2A adrenergic receptor | adrenergic Alpha2A
Type:Enzyme Catalytic Domain
Mol. Mass.:48998.96
Organism:PIG
Description:adrenergic Alpha2 0 PIG::P18871
Residue:450
Sequence:
MGSLQPEAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKAGGGG
QQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAAA
ALPGGAERRPNGLGPERGVGRVGAEAEPLPVQLNGAPGEPAPAGPRDADGLDLEESSSSE
HAERPPGPRRSERGPRAKSKARASQVKPGDSLPRRGPGAPGPGAPATGAGEERGGVAKAS
RWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVGCSVPPTLFKFFFWFGYCNSS
LNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50030614
n/a
NameBDBM50030614
Synonyms:5-Chloro-8-methyl-1-vinyl-6,7,8,9-tetrahydro-2-thia-8-aza-benzo[cd]azulene | CHEMBL25467 | SK&F-104856 | SK-104856 | SKF 104856
TypeSmall organic molecule
Emp. Form.C14H14ClNS
Mol. Mass.263.786
SMILESCN1CCc2c(Cl)ccc3sc(C=C)c(C1)c23
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: