Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR6
LigandBDBM21397
Substrate/Competitorn/a
Ki 1595±n/a nM
CommentsPDSP_1739
Citation Roth BLCraigo SCChoudhary MSUluer AMonsma FJShen YMeltzer HYSibley DR Binding of typical and atypical antipsychotic agents to 5-hydroxytryptamine-6 and 5-hydroxytryptamine-7 receptors. J Pharmacol Exp Ther 268:1403-10 (1994) [PubMed]
More Info.:Get all data from this article
 
HTR6
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-6 | 5-HT6 | 5-hydroxytryptamine receptor 6 | ST-B17 | Serotonin 6 (5-HT6) receptor | Serotonin receptor 6
Type:Enzyme Catalytic Domain
Mol. Mass.:46945.51
Organism:RAT
Description:5-HT6 HTR6 RAT::P31388
Residue:436
Sequence:
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIVLICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTPAPGQC
RLLASLPFVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTAGQALETLQVP
RTPRPGMESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIAQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCVHCPPEHRPALPPPPCGPLTAVP
DQASACSRCCLCLCRQTQIQTPLQGAPRACSSQPSFCCLERPPGTPRHPPGPPLWSTSLS
QTLWSLRYGRIHSVPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21397
n/a
NameBDBM21397
Synonyms:8-[4-(4-fluorophenyl)-4-keto-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxidanylidene-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxobutyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | CHEMBL267930 | MLS000028615 | SMR000058674 | SPIPERONE | Spiroperidol | US9359372, Spiperone | [3H]-Spiroperidol | cid_5265
Typeradiolabeled ligand
Emp. Form.C23H26FN3O2
Mol. Mass.395.4698
SMILESFc1ccc(cc1)C(=O)CCCN1CCC2(CC1)N(CNC2=O)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: