Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdrenaline alpha1
LigandBDBM82505
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_1672
Citation Wardle KAEllis ESBaxter GSKennett GAGaster LMSanger GJ The effects of SB 204070, a highly potent and selective 5-HT4 receptor antagonist, on guinea-pig distal colon. Br J Pharmacol 112:789-94 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
Adrenaline alpha1
Name:Adrenaline alpha1
Synonyms:Oct1 | Organic cation transporter 1 | Slc22a1 | Solute carrier family 22 member 1 | adrenergic Alpha1 | rOCT1
Type:Enzyme Catalytic Domain
Mol. Mass.:61538.40
Organism:RAT
Description:Adrenaline alpha1 0 RAT::Q63089
Residue:556
Sequence:
MPTVDDVLEQVGEFGWFQKQAFLLLCLISASLAPIYVGIVFLGFTPGHYCQNPGVAELSQ
RCGWSQAEELNYTVPGLGPSDEASFLSQCMRYEVDWNQSTLDCVDPLSSLVANRSQLPLG
PCEHGWVYDTPGSSIVTEFNLVCGDAWKVDLFQSCVNLGFFLGSLVVGYIADRFGRKLCL
LVTTLVTSVSGVLTAVAPDYTSMLLFRLLQGMVSKGSWVSGYTLITEFVGSGYRRTTAIL
YQMAFTVGLVGLAGVAYAIPDWRWLQLAVSLPTFLFLLYYWFVPESPRWLLSQKRTTRAV
RIMEQIAQKNGKVPPADLKMLCLEEDASEKRSPSFADLFRTPNLRKHTVILMYLWFSCAV
LYQGLIMHVGATGANLYLDFFYSSLVEFPAAFIILVTIDRIGRIYPIAASNLVTGAACLL
MIFIPHELHWLNVTLACLGRMGATIVLQMVCLVNAELYPTFIRNLGMMVCSALCDLGGIF
TPFMVFRLMEVWQALPLILFGVLGLTAGAMTLLLPETKGVALPETIEEAENLGRRKSKAK
ENTIYLQVQTGKSSST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82505
n/a
NameBDBM82505
Synonyms:CAS_121881 | NSC_121881 | SB204070
TypeSmall organic molecule
Emp. Form.C19H27ClN2O4
Mol. Mass.382.882
SMILESCCCCN1CCC(COC(=O)c2cc(Cl)c(N)c3OCCOc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: