Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
LigandBDBM82505
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_1672
Citation Wardle KAEllis ESBaxter GSKennett GAGaster LMSanger GJ The effects of SB 204070, a highly potent and selective 5-HT4 receptor antagonist, on guinea-pig distal colon. Br J Pharmacol 112:789-94 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
Gamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
Name:Gamma-aminobutyric acid receptor subunit alpha-1 (GABA(A) alpha-1)
Synonyms:Benzodiazepine receptors | GABA A Alpha1Beta2Gamma2 | GABA A Benzodiazepine | GABA A Benzodiazepine Type I | GABA A Benzodiazepine Type II | GABA A Benzodiazepine Type IIL | GABA A Benzodiazepine Type IIM | GABA A Benzodiazepine omega1 | GABA A Benzodiazepine omega2 | GABA A Benzodiazepine omega5 | GABA A alpha1 | GABA A anti-Alpha1 | GABA receptor alpha-1 subunit | GABA, Chloride, TBOB | GABA-PICROTOXIN | Gamma-aminobutyric acid receptor subunit alpha-1 | TBPS
Type:Enzyme
Mol. Mass.:51770.21
Organism:Rattus norvegicus (Rat)
Description:P62813
Residue:455
Sequence:
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM82505
n/a
NameBDBM82505
Synonyms:CAS_121881 | NSC_121881 | SB204070
TypeSmall organic molecule
Emp. Form.C19H27ClN2O4
Mol. Mass.382.882
SMILESCCCCN1CCC(COC(=O)c2cc(Cl)c(N)c3OCCOc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: