Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetadrenergic Alpha2
LigandBDBM35234
Substrate/Competitorn/a
Ki 1094±n/a nM
CommentsPDSP_1348
Citation O'Rourke MFIversen LJLomasney JWBylund DB Species orthologs of the alpha-2A adrenergic receptor: the pharmacological properties of the bovine and rat receptors differ from the human and porcine receptors. J Pharmacol Exp Ther 271:735-40 (1994) [PubMed]
More Info.:Get all data from this article
 
adrenergic Alpha2
Name:Cerebral cortex alpha adrenergic receptor
Synonyms:Alpha-2A adrenergic receptor | Alpha-2A adrenoceptor | Alpha-2A adrenoreceptor | Alpha-2AAR | Alpha-2D adrenergic receptor | Alpha-2Da adrenergic receptor | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha2A | adrenergic Alpha2D
Type:Enzyme Catalytic Domain
Mol. Mass.:49275.13
Organism:BOVINE
Description:adrenergic Alpha2 0 BOVINE::Q28838
Residue:452
Sequence:
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISFEKKRGRSG
QPSAEPRCEINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDATA
AELPGSAERRPNGLGPERGGVGPVGAEVESLQVQLNGAPGEPAPAGAGADALDLEESSSS
EHAERPPGSRRSERGPRAKGKARASQVKPGDSLPRRGPGATGLGAPTAGPAEERSGGGAK
ASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAIGCPVPPTLFKFFFWFGYCN
SSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35234
n/a
NameBDBM35234
Synonyms:DL-[7-3H]norepinephrine | NOREPINEPHRINE | Noradrenaline,(+) | [3H]NE
Typeradiolabeled ligand
Emp. Form.C8H11NO3
Mol. Mass.169.1778
SMILESNCC(O)c1ccc(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: