Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR1D
LigandBDBM10755
Substrate/Competitorn/a
Ki 5.01±n/a nM
CommentsPDSP_150
Citation Boess FGMartin IL Molecular biology of 5-HT receptors. Neuropharmacology 33:275-317 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
HTR1D
Name:HTR1D
Synonyms:5-HT1D | 5-hydroxytryptamine receptor 1D
Type:Enzyme Catalytic Domain
Mol. Mass.:41894.67
Organism:Dog
Description:5-HT1D HTR1D Dog::P11614
Residue:377
Sequence:
MSPPNQSLEGLLQEASNRSLNATETPEAWGPETLQALKISLALLLSIITMATALSNAFVL
TTIFLTRKLHTPANYLIGSLAMTDLLVSILVMPISIAYTTTRTWSFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGRAAVMIATVWVISICISIPPLFWRQAK
AQEDMSDCQVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYVAARNRILNPPSLYGKRFT
TAQLITGSAGSSLCSLSPSLQEERSHAAGPPLFFNHVQVKLAEGVLERKRISAARERKAT
KTLGIILGAFIVCWLPFFVASLVLPICRASCWLHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQRVVHVRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10755
n/a
NameBDBM10755
Synonyms:14C-5-hydroxy tryptamine creatinine disulfate | 2-imino-1-methylimidazolidin-4-one; 3-(2-aminoethyl)-1H-indol-5-ol; bis(sulfuric acid) | 5-HT | 5-Hydroxy Tryptamine | 5-hydroxy tryptamine creatinine disulfate | CHEMBL535832 | Serotonin | [3H]-5-HT
TypeSmall organic molecule
Emp. Form.C10H12N2O
Mol. Mass.176.2151
SMILESNCCc1c[nH]c2ccc(O)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: