Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR1D
LigandBDBM81782
Substrate/Competitorn/a
Ki 34.67±n/a nM
CommentsPDSP_1438
Citation Boess FGMartin IL Molecular biology of 5-HT receptors. Neuropharmacology 33:275-317 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
HTR1D
Name:HTR1D
Synonyms:5-HT1D | 5-hydroxytryptamine receptor 1D
Type:Enzyme Catalytic Domain
Mol. Mass.:41894.67
Organism:Dog
Description:5-HT1D HTR1D Dog::P11614
Residue:377
Sequence:
MSPPNQSLEGLLQEASNRSLNATETPEAWGPETLQALKISLALLLSIITMATALSNAFVL
TTIFLTRKLHTPANYLIGSLAMTDLLVSILVMPISIAYTTTRTWSFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGRAAVMIATVWVISICISIPPLFWRQAK
AQEDMSDCQVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYVAARNRILNPPSLYGKRFT
TAQLITGSAGSSLCSLSPSLQEERSHAAGPPLFFNHVQVKLAEGVLERKRISAARERKAT
KTLGIILGAFIVCWLPFFVASLVLPICRASCWLHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQRVVHVRKAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM81782
n/a
NameBDBM81782
Synonyms:CAS_6270 | NSC_6270 | PAPP
TypeSmall organic molecule
Emp. Form.C9H11NO
Mol. Mass.149.1897
SMILESCCC(=O)c1ccc(N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: