Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR6
LigandBDBM77970
Substrate/Competitorn/a
Ki 53.7±n/a nM
CommentsPDSP_542
Citation Boess FGMartin IL Molecular biology of 5-HT receptors. Neuropharmacology 33:275-317 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
HTR6
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-6 | 5-HT6 | 5-hydroxytryptamine receptor 6 | ST-B17 | Serotonin 6 (5-HT6) receptor | Serotonin receptor 6
Type:Enzyme Catalytic Domain
Mol. Mass.:46945.51
Organism:RAT
Description:5-HT6 HTR6 RAT::P31388
Residue:436
Sequence:
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIVLICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTPAPGQC
RLLASLPFVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTAGQALETLQVP
RTPRPGMESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIAQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCVHCPPEHRPALPPPPCGPLTAVP
DQASACSRCCLCLCRQTQIQTPLQGAPRACSSQPSFCCLERPPGTPRHPPGPPLWSTSLS
QTLWSLRYGRIHSVPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM77970
n/a
NameBDBM77970
Synonyms:3-(2-chloranyl-5,6-dihydrobenzo[b][1]benzazepin-11-yl)-N,N-dimethyl-propan-1-amine;hydrochloride | 3-(2-chloro-5,6-dihydrobenzo[b][1]benzazepin-11-yl)-N,N-dimethyl-1-propanamine;hydrochloride | 3-(2-chloro-5,6-dihydrobenzo[b][1]benzazepin-11-yl)-N,N-dimethylpropan-1-amine;hydrochloride | 3-(2-chloro-5,6-dihydrobenzo[b][1]benzazepin-11-yl)propyl-dimethyl-amine;hydrochloride | CHLORIMIPRAMINE | CLOMIPRAMINE | CLOMIPRAMINE HYDROCHLORIDE | CLOMIPRIMINE | MLS000028511 | SMR000058295 | cid_68539
TypeSmall organic molecule
Emp. Form.C19H23ClN2
Mol. Mass.314.852
SMILESCN(C)CCCN1c2ccccc2CCc2ccc(Cl)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: