Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR2C
LigandBDBM29525
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_880
Citation Gale JDGrossman CJWhitehead JWOxford AWBunce KTHumphrey PP GR113808: a novel, selective antagonist with high affinity at the 5-HT4 receptor. Br J Pharmacol 111:332-8 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
HTR2C
Name:HTR2C
Synonyms:5-HT2C
Type:Enzyme Catalytic Domain
Mol. Mass.:40045.34
Organism:PORCINE
Description:F1RWT6
Residue:351
Sequence:
MFLSSLCSLSDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFN
SRTKAIMKIAIVWAISLGVSVPIPVIGLRDEDKVFVNNTTCVLNDPNFVLIGSFVAFFIP
LTIMVITYCLTIHVLRRQALMLLRGHTEEPPGISLDFLKCCKRNTDEESAANPNQDLNPR
RRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLME
KLLNVFVWIGYVCSGINPLVYTLFNKVYRRAFSNYLRCNYKADKKPPIRQIPRVAATALS
GRELNVNIYRHTNEPVIKKADDNEPGIEMQVENLELPVNPSNVVSERISSV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29525
n/a
NameBDBM29525
Synonyms:3H-GR113808 | CHEMBL518682 | GR 113808 | [3H] GR 113808 | [3H]GR113808
Typeradiolabeled ligand
Emp. Form.C19H27N3O4S
Mol. Mass.393.5
SMILESCn1cc(C(=O)OCC2CCN(CCNS(C)(=O)=O)CC2)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: