Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine Receptors A2a (A2a)
LigandBDBM29525
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_880
Citation Gale JDGrossman CJWhitehead JWOxford AWBunce KTHumphrey PP GR113808: a novel, selective antagonist with high affinity at the 5-HT4 receptor. Br J Pharmacol 111:332-8 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
Adenosine Receptors A2a (A2a)
Name:Adenosine receptor A2a and A3
Synonyms:ADENOSINE A2a | Adenosine A2a receptor (A2a) | Adenosine receptors A2a | Rat striatal adenosine A2a receptor
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:45015.65
Organism:Rattus norvegicus (rat)
Description:Rat A2A receptors expressed in CHO cells.
Residue:410
Sequence:
MGSSVYITVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSLAAADIAVGVLAIPFA
ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGVRAKG
IIAICWVLSFAIGLTPMLGWNNCSQKDGNSTKTCGEGRVTCLFEDVVPMNYMVYYNFFAF
VLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHAAKSLAIIVGLFALC
WLPLHIINCFTFFCSTCRHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRKIIRT
HVLRRQEPFQAGGSSAWALAAHSTEGEQVSLRLNGHPLGVWANGSATHSGRRPNGYTLGL
GGGGSAQGSPRDVELPTQERQEGQEHPGLRGHLVQARVGASSWSSEFAPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM29525
n/a
NameBDBM29525
Synonyms:3H-GR113808 | CHEMBL518682 | GR 113808 | [3H] GR 113808 | [3H]GR113808
Typeradiolabeled ligand
Emp. Form.C19H27N3O4S
Mol. Mass.393.5
SMILESCn1cc(C(=O)OCC2CCN(CCNS(C)(=O)=O)CC2)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: