| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Somatostatin |
|---|
| Ligand | BDBM29525 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_880 |
|---|
| Citation |  Gale, JD; Grossman, CJ; Whitehead, JW; Oxford, AW; Bunce, KT; Humphrey, PP GR113808: a novel, selective antagonist with high affinity at the 5-HT4 receptor. Br J Pharmacol111:332-8 (1994) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Somatostatin |
|---|
| Name: | Somatostatin |
|---|
| Synonyms: | SMS_RAT | Smst | Sst |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 12744.48 |
|---|
| Organism: | RAT |
|---|
| Description: | SOMATOSTATIN 0 0::P60042 |
|---|
| Residue: | 116 |
|---|
| Sequence: | MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEP
NQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
|
|
|
|---|
| BDBM29525 |
|---|
| n/a |
|---|
| Name | BDBM29525 |
|---|
| Synonyms: | 3H-GR113808 | CHEMBL518682 | GR 113808 | [3H] GR 113808 | [3H]GR113808 |
|---|
| Type | radiolabeled ligand |
|---|
| Emp. Form. | C19H27N3O4S |
|---|
| Mol. Mass. | 393.5 |
|---|
| SMILES | Cn1cc(C(=O)OCC2CCN(CCNS(C)(=O)=O)CC2)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
