| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Transmembrane and immunoglobulin domain-containing 3 |
|---|
| Ligand | BDBM82535 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | >10000±n/a nM |
|---|
| Comments | PDSP_2578 |
|---|
| Citation |  van Galen, PJ; van Bergen, AH; Gallo-Rodriguez, C; Melman, N; Olah, ME; IJzerman, AP; Stiles, GL; Jacobson, KA A binding site model and structure-activity relationships for the rat A3 adenosine receptor. Mol Pharmacol45:1101-11 (1994) [PubMed] |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Transmembrane and immunoglobulin domain-containing 3 |
|---|
| Name: | Transmembrane and immunoglobulin domain-containing 3 |
|---|
| Synonyms: | ADENOSINE A3 | ADORA3 | Adora3 protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 25707.75 |
|---|
| Organism: | RAT |
|---|
| Description: | Q4V8H0 |
|---|
| Residue: | 232 |
|---|
| Sequence: | MEPLLLLSLALFSDAMVMDEKVKSGVELDTASAICNYDAHYKDHTKYWCRGYFRDSCNII
AFTPNSSNRVALKDTGDQLIITVSCLVKEDTGWYWCGIQRDFARDDMDFTKLIVTDNRED
RANGLSPGTSGNRTRSCKTSKAVQKAEGSRMSILIVCVLISGLGIIFLISHMSRGRRSQR
NRGVTGKSINRNPQASQAPSMVSIPLTVLPKVPRQNGQQKALQWTGNATKTG
|
|
|
|---|
| BDBM82535 |
|---|
| n/a |
|---|
| Name | BDBM82535 |
|---|
| Synonyms: | 1,3-DihexylX | 1,3-Dihexylxanthine |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H24N4O2 |
|---|
| Mol. Mass. | 316.3981 |
|---|
| SMILES | O=c1n(C2CCCCC2)c2nc[nH]c2c(=O)n1C1CCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
