Reaction Details |
| Report a problem with these data |
Target | Transmembrane and immunoglobulin domain-containing 3 |
---|
Ligand | BDBM82535 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_2578 |
---|
Citation | van Galen, PJ; van Bergen, AH; Gallo-Rodriguez, C; Melman, N; Olah, ME; IJzerman, AP; Stiles, GL; Jacobson, KA A binding site model and structure-activity relationships for the rat A3 adenosine receptor. Mol Pharmacol45:1101-11 (1994) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Transmembrane and immunoglobulin domain-containing 3 |
---|
Name: | Transmembrane and immunoglobulin domain-containing 3 |
Synonyms: | ADENOSINE A3 | ADORA3 | Adora3 protein |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25707.75 |
Organism: | RAT |
Description: | Q4V8H0 |
Residue: | 232 |
Sequence: | MEPLLLLSLALFSDAMVMDEKVKSGVELDTASAICNYDAHYKDHTKYWCRGYFRDSCNII
AFTPNSSNRVALKDTGDQLIITVSCLVKEDTGWYWCGIQRDFARDDMDFTKLIVTDNRED
RANGLSPGTSGNRTRSCKTSKAVQKAEGSRMSILIVCVLISGLGIIFLISHMSRGRRSQR
NRGVTGKSINRNPQASQAPSMVSIPLTVLPKVPRQNGQQKALQWTGNATKTG
|
|
|
BDBM82535 |
---|
n/a |
---|
Name | BDBM82535 |
Synonyms: | 1,3-DihexylX | 1,3-Dihexylxanthine |
Type | Small organic molecule |
Emp. Form. | C17H24N4O2 |
Mol. Mass. | 316.3981 |
SMILES | O=c1n(C2CCCCC2)c2nc[nH]c2c(=O)n1C1CCCCC1 |
Structure |
|