Reaction Details |
| Report a problem with these data |
Target | Transmembrane and immunoglobulin domain-containing 3 |
---|
Ligand | BDBM18137 |
---|
Substrate/Competitor | n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | PDSP_2560 |
---|
Citation | van Galen, PJ; van Bergen, AH; Gallo-Rodriguez, C; Melman, N; Olah, ME; IJzerman, AP; Stiles, GL; Jacobson, KA A binding site model and structure-activity relationships for the rat A3 adenosine receptor. Mol Pharmacol45:1101-11 (1994) [PubMed] |
---|
More Info.: | Get all data from this article |
---|
|
Transmembrane and immunoglobulin domain-containing 3 |
---|
Name: | Transmembrane and immunoglobulin domain-containing 3 |
Synonyms: | ADENOSINE A3 | ADORA3 | Adora3 protein |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 25707.75 |
Organism: | RAT |
Description: | Q4V8H0 |
Residue: | 232 |
Sequence: | MEPLLLLSLALFSDAMVMDEKVKSGVELDTASAICNYDAHYKDHTKYWCRGYFRDSCNII
AFTPNSSNRVALKDTGDQLIITVSCLVKEDTGWYWCGIQRDFARDDMDFTKLIVTDNRED
RANGLSPGTSGNRTRSCKTSKAVQKAEGSRMSILIVCVLISGLGIIFLISHMSRGRRSQR
NRGVTGKSINRNPQASQAPSMVSIPLTVLPKVPRQNGQQKALQWTGNATKTG
|
|
|
BDBM18137 |
---|
n/a |
---|
Name | BDBM18137 |
Synonyms: | AMP | CHEMBL752 | US11185100, TABLE 7.3 | [(2R,3S,4R,5R)-5-adenin-9-yl-3,4-dihydroxy-tetrahydrofuran-2-yl]methyl dihydrogen phosphate;hydrate | adenosine 5 -monophosphate | {[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}phosphonic acid |
Type | Nucleoside or nucleotide |
Emp. Form. | C10H14N5O7P |
Mol. Mass. | 347.2212 |
SMILES | Nc1ncnc2n(cnc12)[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H]1O |
Structure |
|