Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor M4
LigandBDBM50048392
Substrate/Competitorn/a
Ki>10000±n/a nM
CommentsPDSP_444
Citation Stanton TBolden-Watson CCusack BRichelson E Antagonism of the five cloned human muscarinic cholinergic receptors expressed in CHO-K1 cells by antidepressants and antihistaminics. Biochem Pharmacol 45:2352-4 (1993) [PubMed]  Article
More Info.:Get all data from this article
 
Muscarinic acetylcholine receptor M4
Name:Muscarinic acetylcholine receptor M2 and M4
Synonyms:CHRM4 | Cholinergic, muscarinic M4 | Muscarinic acetylcholine receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:53079.31
Organism:Homo sapiens (Human)
Description:Cholinergic, muscarinic M4 CHRM4 HUMAN M3::P08173
Residue:479
Sequence:
MANFTPVNGSSGNQSVRLVTSSSHNRYETVEMVFIATVTGSLSLVTVVGNILVMLSIKVN
RQLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASV
MNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTV
PDNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAK
TLAFLKSPLMKQSVKKPPPGEAAREELRNGKLEEAPPPALPPPPRPVADKDTSNESSSGS
ATQNTKERPATELSTTEATTPAMPAPPLQPRALNPASRWSKIQIVTKQTGNECVTAIEIV
PATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMV
LVNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048392
n/a
NameBDBM50048392
Synonyms:2-(tert-butylamino)-1-(3-chlorophenyl)propan-1-one | BUPROPION | BUPROPION HYDROCHLORIDE | CHEMBL894 | US9944618, Compound ID No. 176
TypeSmall organic molecule
Emp. Form.C13H18ClNO
Mol. Mass.239.741
SMILESCC(NC(C)(C)C)C(=O)c1cccc(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: