| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Delta-type opioid receptor |
|---|
| Ligand | BDBM50008984 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 1000±n/a nM |
|---|
| Comments | PDSP_818 |
|---|
| Citation |  Raynor, K; Kong, H; Chen, Y; Yasuda, K; Yu, L; Bell, GI; Reisine, T Pharmacological characterization of the cloned kappa-, delta-, and mu-opioid receptors. Mol Pharmacol45:330-4 (1994) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Delta-type opioid receptor |
|---|
| Name: | Delta-type opioid receptor |
|---|
| Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40382.98 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
|---|
| Residue: | 372 |
|---|
| Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
|---|
| BDBM50008984 |
|---|
| n/a |
|---|
| Name | BDBM50008984 |
|---|
| Synonyms: | 4-(4-Chloro-benzyl)-2-(1-methyl-azepan-4-yl)-2H-phthalazin-1-one | CHEMBL596 | Duragesic-100 | Duragesic-12 | Duragesic-25 | Duragesic-50 | Duragesic-75 | FENTANYL | FENTANYL CITRATE | FENTANYL-HCl | Fentanyl-100 | Fentanyl-12 | Fentanyl-25 | Fentanyl-50 | Fentanyl-75 | Fentora | Innovar | Ionsys | N-(1-Phenethyl-piperidin-4-yl)-N-phenyl-propionamide | N-(1-Phenethyl-piperidin-4-yl)-N-phenyl-propionamide(Fentanyl) | N-(1-phenethylpiperidin-4-yl)-N-phenylpropionamide | US20230399418, Compound Fentanyl |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H28N2O |
|---|
| Mol. Mass. | 336.4705 |
|---|
| SMILES | CCC(=O)N(C1CCN(CCc2ccccc2)CC1)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
