Reaction Details |
| Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50105085 |
---|
Substrate/Competitor | n/a |
---|
Ki | 1000±n/a nM |
---|
Comments | PDSP_1277 |
---|
Citation | Raynor, K; Kong, H; Chen, Y; Yasuda, K; Yu, L; Bell, GI; Reisine, T Pharmacological characterization of the cloned kappa-, delta-, and mu-opioid receptors. Mol Pharmacol45:330-4 (1994) [PubMed] Article |
---|
More Info.: | Get all data from this article |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50105085 |
---|
n/a |
---|
Name | BDBM50105085 |
Synonyms: | 17-cyclobutylmethyl-4,5alpha-epoxymorphinan-3,6alpha,14-triol | CHEMBL895 | N-cyclobutylmethyl-4,5alpha-epoxy-3,6alpha,14-morphinantriol | NALBUPHINE | US10231963, Table B.1 | US10512644, Compound Nalbuphine | US11534436, Compound Table B.1 | US9233167, Nalbuphine | US9656961, Example 00118 | USRE49340, Rank 9 |
Type | Small organic molecule |
Emp. Form. | C21H27NO4 |
Mol. Mass. | 357.4434 |
SMILES | O[C@H]1CC[C@@]2(O)[C@H]3Cc4ccc(O)c5O[C@@H]1[C@]2(CCN3CC1CCC1)c45 |r| |
Structure |
|