| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melatonin receptor |
|---|
| Ligand | BDBM50043289 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 4±n/a nM |
|---|
| Comments | PDSP_7419 |
|---|
| Citation |  Morgan, PJ; Barrett, P; Howell, HE; Helliwell, R Melatonin receptors: localization, molecular pharmacology and physiological significance. Neurochem Int24:101-46 (1994) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Melatonin receptor |
|---|
| Name: | Melatonin receptor |
|---|
| Synonyms: | Melatonin | Melatonin receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13287.02 |
|---|
| Organism: | RABBIT |
|---|
| Description: | Q9BE38 |
|---|
| Residue: | 114 |
|---|
| Sequence: | MIWMLTLVAVMPNLHTGTLQYDPRVYSCTFSQSVSSAYTIAVVVFHFIIPMLMSSCCYLR
IWILVLQVRRRVKPDNKPKLKPQDFRNFITMFVVFVLFAICWAPLNFIVLLGRS
|
|
|
|---|
| BDBM50043289 |
|---|
| n/a |
|---|
| Name | BDBM50043289 |
|---|
| Synonyms: | CHEMBL34730 | N-[2-(6-Chloro-5-methoxy-1H-indol-3-yl)-ethyl]-acetamide | N-[2-(6-Chloro-5-methoxy-1H-indol-3-yl)-ethyl]-acetamide(6-Chloromelatonin) | melatonin, 6-Chloro |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H15ClN2O2 |
|---|
| Mol. Mass. | 266.723 |
|---|
| SMILES | COc1cc2c(CCNC(C)=O)c[nH]c2cc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
