| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melatonin receptor |
|---|
| Ligand | BDBM29612 |
|---|
| Substrate/Competitor | n/a |
|---|
| Ki | 3000±n/a nM |
|---|
| Comments | PDSP_1708 |
|---|
| Citation |  Morgan, PJ; Barrett, P; Howell, HE; Helliwell, R Melatonin receptors: localization, molecular pharmacology and physiological significance. Neurochem Int24:101-46 (1994) [PubMed] Article |
|---|
| More Info.: | Get all data from this article |
|---|
| |
| Melatonin receptor |
|---|
| Name: | Melatonin receptor |
|---|
| Synonyms: | Melatonin | Melatonin receptor |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 13287.02 |
|---|
| Organism: | RABBIT |
|---|
| Description: | Q9BE38 |
|---|
| Residue: | 114 |
|---|
| Sequence: | MIWMLTLVAVMPNLHTGTLQYDPRVYSCTFSQSVSSAYTIAVVVFHFIIPMLMSSCCYLR
IWILVLQVRRRVKPDNKPKLKPQDFRNFITMFVVFVLFAICWAPLNFIVLLGRS
|
|
|
|---|
| BDBM29612 |
|---|
| n/a |
|---|
| Name | BDBM29612 |
|---|
| Synonyms: | CHEMBL33103 | CVD-0001578 | JOH-MSK-a63bdd1d-4 | N-ACETYL SEROTONIN | N-Acetyl-5-hydroxytryptamine | N-Acetyltryptamine,5-Hydroxy | N-acetylserotonin | Normelatonin | Serotonin,N-acetyl |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H14N2O2 |
|---|
| Mol. Mass. | 218.2518 |
|---|
| SMILES | CC(=O)NCCc1c[nH]c2ccc(O)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
