Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHTR6
LigandBDBM50014406
Substrate/Competitorn/a
Ki 398.1±n/a nM
CommentsPDSP_154
Citation Unsworth CDMolinoff PB Characterization of a 5-hydroxytryptamine receptor in mouse neuroblastoma N18TG2 cells. J Pharmacol Exp Ther 269:246-55 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
HTR6
Name:HTR6
Synonyms:5-HT6 | 5-hydroxytryptamine receptor 6
Type:Enzyme Catalytic Domain
Mol. Mass.:47012.98
Organism:MOUSE
Description:5-HT6 HTR6 MOUSE::Q9R1C8
Residue:440
Sequence:
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTAPRALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQC
RLLASLPYVLVASGVTFFLPSGAICFTYCRILLAARKQAVQVASLTTGTATAGQALETLQ
VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFFVTWLPFFVASIAQAVCDCIS
PGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASPASPSMWTSHS
GARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF
FVTDSVEPEIRQHPLGSPMN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014406
n/a
NameBDBM50014406
Synonyms:2-Me 5-HT | 2-Methyl-5-hydroxytryptamine | 2-methyl-5-HT | 2-methylserotonin | 3-(2-aminoethyl)-2-methyl-1H-indol-5-ol | 5-HT,2-Me | CHEMBL266591
TypeSmall organic molecule
Emp. Form.C11H14N2O
Mol. Mass.190.2417
SMILESCc1[nH]c2ccc(O)cc2c1CCN
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: