Reaction Details |
| Report a problem with these data |
Target | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 |
---|
Ligand | BDBM82667 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Dose Response confirmation of uHTS hits for Scp-1 phosphatase using a colorimetric assay |
---|
IC50 | 844±130 nM |
---|
Citation | PubChem, PC Dose Response confirmation of uHTS hits for Scp-1 phosphatase using a colorimetric assay PubChem Bioassay(2011)[AID] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 |
---|
Name: | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 |
Synonyms: | CTDS1_HUMAN | CTDSP1 | NIF3 | NLIIF | SCP1 | carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 isoform 1 |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 29199.89 |
Organism: | Homo sapiens (Human) |
Description: | gi_10864009 |
Residue: | 261 |
Sequence: | MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGA
PLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEI
DGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRES
CVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPF
FEQLSRVDDVYSVLRQPRPGS
|
|
|
BDBM82667 |
---|
n/a |
---|
Name | BDBM82667 |
Synonyms: | (E)-N-[2-[(N''E)-N''-[1-(4-ethylphenyl)ethylidene]hydrazino]-2-keto-ethyl]-3-(2-furyl)acrylamide | (E)-N-[2-[(N'E)-N'-[1-(4-ethylphenyl)ethylidene]hydrazino]-2-keto-ethyl]-3-(2-furyl)acrylamide | (E)-N-[2-[2-[1-(4-ethylphenyl)ethylidene]hydrazinyl]-2-oxidanylidene-ethyl]-3-(furan-2-yl)prop-2-enamide | (E)-N-[2-[2-[1-(4-ethylphenyl)ethylidene]hydrazinyl]-2-oxoethyl]-3-(2-furanyl)-2-propenamide | (E)-N-[2-[2-[1-(4-ethylphenyl)ethylidene]hydrazinyl]-2-oxoethyl]-3-(furan-2-yl)prop-2-enamide | (E)-N-[2-[N'-[1-(4-ethylphenyl)ethylidene]hydrazino]-2-keto-ethyl]-3-(2-furyl)acrylamide | MLS000562653 | N-[1-(4-Ethyl-phenyl)-ethylidene-hydrazinocarbonylmethyl]-3-furan-2-yl-acrylamide | SMR000174285 | cid_11957316 |
Type | Small organic molecule |
Emp. Form. | C19H21N3O3 |
Mol. Mass. | 339.3883 |
SMILES | CCc1ccc(cc1)C(C)=NNC(=O)CNC(=O)C=Cc1ccco1 |w:10.11,18.18| |
Structure |
|