| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 |
|---|
| Ligand | BDBM82771 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Dose Response confirmation of uHTS hits for Scp-1 phosphatase using a colorimetric assay |
|---|
| IC50 | 632±48 nM |
|---|
| Citation |  PubChem, PC Dose Response confirmation of uHTS hits for Scp-1 phosphatase using a colorimetric assay PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 |
|---|
| Name: | Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 |
|---|
| Synonyms: | CTDS1_HUMAN | CTDSP1 | NIF3 | NLIIF | SCP1 | carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 isoform 1 |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 29199.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | gi_10864009 |
|---|
| Residue: | 261 |
|---|
| Sequence: | MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGA
PLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEI
DGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRES
CVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPF
FEQLSRVDDVYSVLRQPRPGS
|
|
|
|---|
| BDBM82771 |
|---|
| n/a |
|---|
| Name | BDBM82771 |
|---|
| Synonyms: | (5E)-5-(4-methoxy-3-methyl-benzylidene)-1-methyl-2-thioxo-hexahydropyrimidine-4,6-quinone | (5E)-5-[(4-methoxy-3-methyl-phenyl)methylidene]-1-methyl-2-sulfanylidene-1,3-diazinane-4,6-dione | (5E)-5-[(4-methoxy-3-methylphenyl)methylidene]-1-methyl-2-sulfanylidene-1,3-diazinane-4,6-dione | 5-(4-methoxy-3-methylbenzylidene)-1-methyl-2-thioxodihydropyrimidine-4,6(1H,5H)-dione | MLS000698824 | SMR000226501 | cid_900247 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H14N2O3S |
|---|
| Mol. Mass. | 290.338 |
|---|
| SMILES | COc1ccc(\C=C2/C(=O)NC(=S)N(C)C2=O)cc1C |
|---|
| Structure | 
|
|---|
Search and Browse
