new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetcarboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 isoform 1
LigandBDBM35730
Substrate/Competitorn/a
Meas. Tech.Dose Response confirmation of uHTS hits for Scp-1 phosphatase using a colorimetric assay
IC50 4177±171 nM
Citation PubChem PC Dose Response confirmation of uHTS hits for Scp-1 phosphatase using a colorimetric assay PubChem Bioassay (2011)[AID]  Article
More Info.:Get all data from this article,  Assay Method
 
carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 isoform 1
Name:carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 isoform 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:29199.89
Organism:Homo sapiens (Human)
Description:gi_10864009
Residue:261
Sequence:
MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGA
PLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEI
DGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRES
CVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPF
FEQLSRVDDVYSVLRQPRPGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM35730
n/a
NameBDBM35730
Synonyms:cid_694792 | sulfonamide deriv., 5e
TypeSmall organic molecule
Emp. Form.C13H14N2O3S2
Mol. Mass.310.392
SMILESNS(=O)(=O)c1ccc(CNC(=O)Cc2cccs2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: