| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Orotidine 5'-phosphate decarboxylase |
|---|
| Ligand | BDBM80079 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Luminescence-based cell-based high throughput dose response assay for activators of the GAA850 frataxin (FXN) promoter |
|---|
| EC50 | >59718±n/a nM |
|---|
| Citation |  PubChem, PC Luminescence-based cell-based high throughput dose response assay for activators of the GAA850 frataxin (FXN) promoter PubChem Bioassay(2011)[AID] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Orotidine 5'-phosphate decarboxylase |
|---|
| Name: | Orotidine 5'-phosphate decarboxylase |
|---|
| Synonyms: | FXN frataxin | PYRF_ASPNG | pyrA | pyrG |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 30195.13 |
|---|
| Organism: | Aspergillus niger |
|---|
| Description: | gi_2395 |
|---|
| Residue: | 277 |
|---|
| Sequence: | MSSKSQLTYTARASKHPNALAKRLFEIAEAKKTNVTVSADVTTTKELLDLADRLGPYIAV
IKTHIDILSDFSDETIEGLKALAQKHNFLIFEDRKFIDIGNTVQKQYHRGTLRISEWAHI
INCSILPGEGIVEALAQTASAPDFSYGPERGLLILAEMTSKGSLATGQYTTSSVDYARKY
KNFVMGFVSTRSLGEVQSEVSSPSDEEDFVVFTTGVNISSKGDKLGQQYQTPASAIGRGA
DFIIAGRGIYAAPDPVQAAQQYQKEGWEAYLARVGGN
|
|
|
|---|
| BDBM80079 |
|---|
| n/a |
|---|
| Name | BDBM80079 |
|---|
| Synonyms: | 5-bromanyl-1-[[4-methylidene-5-oxidanylidene-2-(4-phenylphenyl)oxolan-2-yl]methyl]pyrimidine-2,4-dione | 5-bromo-1-[[4-methylene-5-oxo-2-(4-phenylphenyl)-2-oxolanyl]methyl]pyrimidine-2,4-dione | 5-bromo-1-[[4-methylidene-5-oxo-2-(4-phenylphenyl)oxolan-2-yl]methyl]pyrimidine-2,4-dione | 5-bromo-1-[[5-keto-4-methylene-2-(4-phenylphenyl)tetrahydrofuran-2-yl]methyl]pyrimidine-2,4-quinone | MLS002702193 | SMR001565756 | cid_381504 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H17BrN2O4 |
|---|
| Mol. Mass. | 453.285 |
|---|
| SMILES | Brc1cn(CC2(CC(=C)C(=O)O2)c2ccc(cc2)-c2ccccc2)c(=O)[nH]c1=O |
|---|
| Structure | 
|
|---|
Search and Browse
