new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptotic peptidase activating factor 1
LigandBDBM58032
Substrate/Competitorn/a
Meas. Tech.Dose response confirmation of uHTS hits for Apaf-1 in a Fluorescent assay
IC50>100000±n/a nM
Citation PubChem PC Dose response confirmation of uHTS hits for Apaf-1 in a Fluorescent assay PubChem Bioassay (2011)[AID]  Article
More Info.:Get all data from this article,  Assay Method
 
Apoptotic peptidase activating factor 1
Name:Apoptotic peptidase activating factor 1
Synonyms:n/a
Type:Enzyme Catalytic Domain
Mol. Mass.:141834.40
Organism:Homo sapiens (Human)
Description:O14727
Residue:1248
Sequence:
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYVSFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDSQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQPHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS
SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDATSANERKS
INVKQFFLNLEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHH
STIQYCDFSPQNHLAVVALSQYCVELWNTDSRSKVADCRGHLSWVHGVMFSPDGSSFLTS
SDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIRRLQLINGRTGQIDYLT
EAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLIS
SSDDAEIQVWNWQLDKCIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNKEKD
FVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDLLLPLHELRGHNGCVRCSAFSVDST
LLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK
WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM58032
n/a
NameBDBM58032
Synonyms:2-(1,3-Dioxo-indan-2-yl)-2-(2-methyl-1H-indol-3-yl)-malononitrile | 2-(1,3-diketoindan-2-yl)-2-(2-methyl-1H-indol-3-yl)malononitrile | 2-(1,3-dioxo-2-indenyl)-2-(2-methyl-1H-indol-3-yl)propanedinitrile | 2-(1,3-dioxoinden-2-yl)-2-(2-methyl-1H-indol-3-yl)propanedinitrile | 2-[1,3-bis(oxidanylidene)inden-2-yl]-2-(2-methyl-1H-indol-3-yl)propanedinitrile | MLS000779290 | SMR000416004 | cid_582632
TypeSmall organic molecule
Emp. Form.C21H13N3O2
Mol. Mass.339.3468
SMILESCc1[nH]c2ccccc2c1C(C#N)(C#N)C1C(=O)c2ccccc2C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: