new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C (PKC)
LigandBDBM3151
Substrate/CompetitorLysine-rich histone
Meas. Tech.PKC assay
IC50>150000±n/a nM
Citation Lai YSMenaldino DSNichols JBJagdmann GEMylott FGillespie JHall SE Ring Size effect in the PKC inhibitory activities of perhydroazepine analogs of balanol. Bioorg Med Chem Lett 5:2151-4 (1995)    Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Protein kinase C (PKC)
Name:Protein kinase C iota type/zeta type
Synonyms:Protein Kinase C, zeta | Protein kinase C zeta | Protein kinase C zeta (PKCζ) | Protein kinase C zeta type | Protein kinase C zeta type (PKC zeta) | Protein kinase C zeta type (PKCzeta) | nPKC-zeta
Type:Enzyme
Mol. Mass.:67649.13
Organism:Homo sapiens (Human)
Description:n/a
Residue:592
Sequence:
MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKW
VDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTC
RKHMDSVMPSQEPPVDDKNEDADLPSEETDGIAYISSSRKHDSIKDDSEDLKPVIDGMDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDAIKRIDQSEFEGFEYINPLLLSTEESV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM3151
Lysine-rich histone
Name:Lysine-rich histone
Synonyms:ING Peptide | Lys-rich histone | histone type IIIS
Type:Peptide
Mol. Mass.:10508.21
Organism:Bos taurus (bovine)
Description:Purified as a lysine rich fraction of histone H1 from calf thymus.
Residue:105
Sequence:
SETAPAAPAAAPPAEKTPVKKKAAKKPAGARRKASGPPVSELITKAVAASKERSGVSLAA
LKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: