Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetToll-like receptor 8
LigandBDBM274105
Substrate/Competitorn/a
Meas. Tech.TLR7/8/9 Inhibition Reporter Assay
Temperature298.15±n/a K
IC50 5.20±n/a nM
Commentsextracted
Citation Dyckman AJDodd DSMacor JEMussari CPPasunoori LKumar SRSherwood TCSistla RK [1,2,4]triazolo[1,5-a]pyridinyl substituted indole compounds US Patent  US10071079 Publication Date 9/11/2018
More Info.:Get all data from this article,  Assay Method
 
Toll-like receptor 8
Name:Toll-like receptor 8
Synonyms:CD_antigen: CD288 | TRL8
Type:Enzyme
Mol. Mass.:119828.77
Organism:Homo sapiens (Human)
Description:Q9NR97
Residue:1041
Sequence:
MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQT
VGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGA
FLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWN
CYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEE
DFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLR
KINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINIS
RNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNL
EIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCA
AYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNN
RLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLT
DKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFL
NLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLS
HNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDI
GDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITT
MVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINE
LRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAF
YLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRN
VVLTENDSRYNNMYVDSIKQY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM274105
n/a
NameBDBM274105
Synonyms:US10071079, Example 891
TypeSmall organic molecule
Emp. Form.C29H37N7O2
Mol. Mass.515.6498
SMILESCC(C)c1c([nH]c2ccc(cc12)C1CCN(CC1)C(=O)CCNCC(N)=O)-c1cn2ncnc2c(C)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: