Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 1
LigandBDBM84626
Substrate/Competitorn/a
Ki 1000±n/a nM
CommentsPDSP_377
Citation Patel YCSrikant CB Subtype selectivity of peptide analogs for all five cloned human somatostatin receptors (hsstr 1-5). Endocrinology 135:2814-7 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
Somatostatin receptor type 1
Name:Somatostatin receptor type 1
Synonyms:SOMATOSTATIN SST1 | SRIF-2 | SS-1-R | SS1-R | SS1R | SSTR1 | Somatostatin receptor type 1 (SSTR1)
Type:Enzyme
Mol. Mass.:42692.81
Organism:Homo sapiens (Human)
Description:P30872
Residue:391
Sequence:
MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCTSRITTL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM84626
n/a
NameBDBM84626
Synonyms:BIM 23034
TypeSmall organic molecule
Emp. Form.C55H64N10O8S2
Mol. Mass.1057.289
SMILESCC1NC(=O)C(CCCCN)NC(=O)C(Cc2c[nH]c3ccccc23)NC(=O)C(Cc2ccc(O)cc2)NC(=O)C(CSSCC(NC1=O)C(=O)NCc1cccc2ccccc12)NC(=O)C(N)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: