Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSomatostatin receptor type 3
LigandBDBM50097783
Substrate/Competitorn/a
Ki 0.35±n/a nM
CommentsPDSP_3355
Citation Patel YCSrikant CB Subtype selectivity of peptide analogs for all five cloned human somatostatin receptors (hsstr 1-5). Endocrinology 135:2814-7 (1994) [PubMed]  Article
More Info.:Get all data from this article
 
Somatostatin receptor type 3
Name:Somatostatin receptor type 3
Synonyms:SOMATOSTATIN SST3 | SS-3-R | SS3-R | SS3R | SSR-28 | SSTR3 | Somatostatin receptor type 3 (SSTR3)
Type:Protein
Mol. Mass.:45855.97
Organism:Homo sapiens (Human)
Description:P32745
Residue:418
Sequence:
MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL
GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM
AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV
FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV
WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA
LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE
SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50097783
n/a
NameBDBM50097783
Synonyms:CHEMBL438401 | D-Trp8 SST-14 | SOMATOSTATIN | SRIF-D-Trp8
TypeSmall organic molecule
Emp. Form.C76H104N18O19S2
Mol. Mass.1637.878
SMILESC[C@@H](O)[C@@H]1NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@@H](NC(=O)[C@@H](CCCCN)NC(=O)[C@H](Cc2c[nH]c3ccccc23)NC(=O)[C@@H](Cc2ccccc2)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CSSC[C@@H](NC(=O)[C@@H](CO)NC1=O)C(O)=O)NC(=O)CNC(=O)[C@H](C)N)C(C)O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: